PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400044272
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 144aa    MW: 16686.2 Da    PI: 10.6255
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400044272genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.21.6e-31959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          krien++nrqvtf+kRrng+lKKA+ELSvLCdae+a+i+fs++g+lyeys+
  PGSC0003DMP400044272  9 KRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRLYEYSN 59
                          79***********************************************95 PP

2K-box73.94.5e-2579142669
                 K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69 
                              ++e +a+ +qqe++kL+++i+ +q+++Rhl+Ge+L sL+++eL+qLe++Le+++++iRskK
  PGSC0003DMP400044272  79 AYTTQELNAQFYQQESKKLRQQIQLMQNTNRHLVGEGLCSLNVRELKQLENRLERGITRIRSKK 142
                           33488999*******************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.852161IPR002100Transcription factor, MADS-box
SMARTSM004323.6E-41160IPR002100Transcription factor, MADS-box
CDDcd002651.60E-42278No hitNo description
SuperFamilySSF554551.96E-33280IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.6E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-333859IPR002100Transcription factor, MADS-box
PfamPF014862.3E-1883142IPR002487Transcription factor, K-box
PROSITE profilePS5129711.52187143IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MGRGKIEIKR IENNTNRQVT FCKRRNGLLK KAYELSVLCD AEIALIVFST RGRLYEYSNN  60
NVKATIERYK KATAETSSAY TTQELNAQFY QQESKKLRQQ IQLMQNTNRH LVGEGLCSLN  120
VRELKQLENR LERGITRIRS KKV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S3e-22169169Myocyte-specific enhancer factor 2B
1tqe_R3e-22169169Myocyte-specific enhancer factor 2B
1tqe_Q3e-22169169Myocyte-specific enhancer factor 2B
1tqe_P3e-22169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0987360.0AY098736.2 Lycopersicon esculentum TAGL11 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006339358.11e-98PREDICTED: agamous-like MADS-box protein AGL11
SwissprotQ388361e-78AGL11_ARATH; Agamous-like MADS-box protein AGL11
TrEMBLA0A0V0HHT91e-98A0A0V0HHT9_SOLCH; Putative agamous-like MADS-box protein AGL11-like
TrEMBLM1CEC03e-99M1CEC0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000656145e-98(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.25e-80MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]